Product Number |
ARP38875_T100 |
Product Page |
www.avivasysbio.com/zfp36l2-antibody-n-terminal-region-arp38875-t100.html |
Name |
ZFP36L2 Antibody - N-terminal region (ARP38875_T100) |
Protein Size (# AA) |
494 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
678 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 36, C3H type-like 2 |
Alias Symbols |
BRF2, ERF2, ERF-2, TIS11D, RNF162C |
Peptide Sequence |
Synthetic peptide located within the following region: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hudson,B.P., (2004) Prog. Nucleic Acid Res. Mol. Biol. 11 (3), 257-264 |
Description of Target |
ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. |
Protein Interactions |
YWHAB; YWHAE; UBC; CUL3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZFP36L2 (ARP38875_T100) antibody |
Blocking Peptide |
For anti-ZFP36L2 (ARP38875_T100) antibody is Catalog # AAP38875 (Previous Catalog # AAPS05609) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L2 |
Uniprot ID |
Q53TB4 |
Protein Name |
Zinc finger protein 36, C3H1 type-like 2 |
Sample Type Confirmation |
ZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_008818 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006887 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZFP36L2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysateZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|