ZFP36L2 Antibody - N-terminal region (ARP38875_T100)

Data Sheet
 
Product Number ARP38875_T100
Product Page www.avivasysbio.com/zfp36l2-antibody-n-terminal-region-arp38875-t100.html
Name ZFP36L2 Antibody - N-terminal region (ARP38875_T100)
Protein Size (# AA) 494 amino acids
Molecular Weight 51kDa
NCBI Gene Id 678
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 36, C3H type-like 2
Alias Symbols BRF2, ERF2, ERF-2, TIS11D, RNF162C
Peptide Sequence Synthetic peptide located within the following region: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hudson,B.P., (2004) Prog. Nucleic Acid Res. Mol. Biol. 11 (3), 257-264
Description of Target ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Protein Interactions YWHAB; YWHAE; UBC; CUL3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFP36L2 (ARP38875_T100) antibody
Blocking Peptide For anti-ZFP36L2 (ARP38875_T100) antibody is Catalog # AAP38875 (Previous Catalog # AAPS05609)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L2
Uniprot ID Q53TB4
Protein Name Zinc finger protein 36, C3H1 type-like 2
Sample Type Confirmation

ZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_008818
Purification Protein A purified
Nucleotide Accession # NM_006887
Tested Species Reactivity Human
Gene Symbol ZFP36L2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com