ZBTB33 Antibody - N-terminal region (ARP38864_P050)

• Product Number: ARP38864_P050
• Name: ZBTB33 Antibody - N-terminal region (ARP38864_P050)
• Protein Size (# AA): 672 amino acids
• Molecular Weight: 74kDa
• NCBI Gene Id: 10009
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: zinc finger and BTB domain containing 33
• Alias Symbols: ZNF348, ZNF-kaiso
• Peptide Sequence: Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Defossez,P.A., (2005) J. Biol. Chem. 280 (52), 43017-43023
• Description of Target: This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.
• Protein Interactions: HUWE1; SUMO2; SUMO3; CBFA2T3; LMNA; UBC; TCF7L2; KPNA2; CTNND1; CTNNB1; CTCF; ELAVL1; CTNND2; WDR48; NCOR1; ZBTB33; HDAC3; WNT11; S100A4; MMP7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZBTB33 (ARP38864_P050) antibody is Catalog # AAP38864 (Previous Catalog # AAPP21071)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB33
• Uniprot ID: Q86T24
• Protein Name: transcriptional regulator Kaiso
• Protein Accession #: NP_006768
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006777
• Tested Species Reactivity: Human
• Gene Symbol: ZBTB33
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZBTB33 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate