| Product Number |
ARP38847_P050 |
| Product Page |
www.avivasysbio.com/ppp1r13l-antibody-middle-region-arp38847-p050.html |
| Name |
PPP1R13L Antibody - middle region (ARP38847_P050) |
| Protein Size (# AA) |
828 amino acids |
| Molecular Weight |
89kDa |
| NCBI Gene Id |
10848 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein phosphatase 1, regulatory subunit 13 like |
| Alias Symbols |
RAI, RAI4, IASPP, NKIP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tomoda,K., (2008) Cancer Sci. 99 (3), 615-622 |
| Description of Target |
IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53. IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
TP53; CEP57; AURKB; PPP1CA; UBC; PPP1R13L; SP1; RELA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PPP1R13L (ARP38847_P050) antibody |
| Blocking Peptide |
For anti-PPP1R13L (ARP38847_P050) antibody is Catalog # AAP38847 (Previous Catalog # AAPP21054) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L |
| Uniprot ID |
Q8WUF5 |
| Protein Name |
RelA-associated inhibitor |
| Protein Accession # |
NP_006654 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006663 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PPP1R13L |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Lung
 | WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
|
