ELL Antibody - N-terminal region (ARP38813_T100)

Data Sheet
 
Product Number ARP38813_T100
Product Page www.avivasysbio.com/ell-antibody-n-terminal-region-arp38813-t100.html
Name ELL Antibody - N-terminal region (ARP38813_T100)
Protein Size (# AA) 621 amino acids
Molecular Weight 68kDa
NCBI Gene Id 8178
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Elongation factor RNA polymerase II
Alias Symbols MEN, ELL1, PPP1R68, C19orf17
Peptide Sequence Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wiederschain,D., (2003) Mol. Cell. Biol. 23 (12), 4230-4246
Description of Target ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene.
Protein Interactions UBC; LOC100363176; SNF8; MCM2; Polr2e; Polr2l; Polr2h; Polr2d; Polr2a; Polr2c; Polr2i; Polr2b; Polr2j; Polr2g; Polr2f; EAF1; ICE2; AFF4; PPP1CA; ICE1; MED26; MLLT3; CDK9; TFPT; KMT2A; MLLT1; USPL1; EAF2; HNRNPU; TP53; ZHX1; SIRT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ELL (ARP38813_T100) antibody
Blocking Peptide For anti-ELL (ARP38813_T100) antibody is Catalog # AAP38813 (Previous Catalog # AAPP21022)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ELL
Uniprot ID P55199
Protein Name RNA polymerase II elongation factor ELL
Protein Accession # NP_006523
Purification Protein A purified
Nucleotide Accession # NM_006532
Tested Species Reactivity Human
Gene Symbol ELL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Image 1
Human Muscle
Human Muscle
Image 2
Transfected 293T
WB Suggested Anti-ELL Antibody Titration: 7.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com