Product Number |
ARP38813_T100 |
Product Page |
www.avivasysbio.com/ell-antibody-n-terminal-region-arp38813-t100.html |
Name |
ELL Antibody - N-terminal region (ARP38813_T100) |
Protein Size (# AA) |
621 amino acids |
Molecular Weight |
68kDa |
NCBI Gene Id |
8178 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Elongation factor RNA polymerase II |
Alias Symbols |
MEN, ELL1, PPP1R68, C19orf17 |
Peptide Sequence |
Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wiederschain,D., (2003) Mol. Cell. Biol. 23 (12), 4230-4246 |
Description of Target |
ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene. |
Protein Interactions |
UBC; LOC100363176; SNF8; MCM2; Polr2e; Polr2l; Polr2h; Polr2d; Polr2a; Polr2c; Polr2i; Polr2b; Polr2j; Polr2g; Polr2f; EAF1; ICE2; AFF4; PPP1CA; ICE1; MED26; MLLT3; CDK9; TFPT; KMT2A; MLLT1; USPL1; EAF2; HNRNPU; TP53; ZHX1; SIRT2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ELL (ARP38813_T100) antibody |
Blocking Peptide |
For anti-ELL (ARP38813_T100) antibody is Catalog # AAP38813 (Previous Catalog # AAPP21022) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ELL |
Uniprot ID |
P55199 |
Protein Name |
RNA polymerase II elongation factor ELL |
Protein Accession # |
NP_006523 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006532 |
Tested Species Reactivity |
Human |
Gene Symbol |
ELL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rat: 92% |
Image 1 | Human Muscle
| Human Muscle |
|
Image 2 | Transfected 293T
| WB Suggested Anti-ELL Antibody Titration: 7.5ug/ml ELISA Titer: 1:1562500 Positive Control: Transfected 293T |
|