| Product Number |
ARP38810_T100 |
| Product Page |
www.avivasysbio.com/tfeb-antibody-c-terminal-region-arp38810-t100.html |
| Name |
TFEB Antibody - C-terminal region (ARP38810_T100) |
| Protein Size (# AA) |
476 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
7942 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transcription factor EB |
| Alias Symbols |
TCFEB, BHLHE35, ALPHATFEB |
| Peptide Sequence |
Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Argani,P., et al., (2005) Am. J. Surg. Pathol. 29 (2), 230-240 |
| Description of Target |
TFEB is a member of the basic Helix-Loop-Helix-Zipper family of transcription factors. TFEB can bind DNA as a homodimer or as a heterodimer with three closely related family members: MITF, TFE3 and TFEC. The t(6;11)(p21;q12), a translocation recently been shown to result in fusion of Alpha, a gene on 11q12, with the transcription factor gene TFEB on 6p21.This translocation ultimately leads to the development of Renal carcinomas. |
| Protein Interactions |
SRPK1; YWHAQ; TFEC; TFE3; MITF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFEB (ARP38810_T100) antibody |
| Blocking Peptide |
For anti-TFEB (ARP38810_T100) antibody is Catalog # AAP38810 (Previous Catalog # AAPP21019) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TFEB |
| Uniprot ID |
P19484 |
| Protein Name |
Transcription factor EB |
| Protein Accession # |
NP_009093 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007162 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TFEB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Yeast: 100%; Zebrafish: 91% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TFEB Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Mouse Brain
 | Host: Mouse
Target Name: TFE3
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml |
|
