TSG101 Antibody - C-terminal region (ARP38773_T100)

• Product Number: ARP38773_T100
• Name: TSG101 Antibody - C-terminal region (ARP38773_T100)
• Protein Size (# AA): 390 amino acids
• Molecular Weight: 44 kDa
• NCBI Gene Id: 7251
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Tumor susceptibility gene 101
• Alias Symbols: TSG10, VPS23
• Peptide Sequence: Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Surjit,M., et al., (2006) J. Biol. Chem. 281 (12), 8135-8142
• Description of Target: TSG101 belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. TSG101 contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. TSG101 may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of TSG101 appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in TSG101 gene occur in high frequency in breast cancer. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
• Protein Interactions: USHBP1; CEP55; VPS37C; VPS28; AATF; MGRN1; PDLIM7; TAX1BP1; KRT31; KRT13; KIFC3; DAPK3; AR; FAM9B; VPS37A; HAUS1; SYCE1; UBC; LRSAM1; ADRB2; MVB12A; UBAP1; CDKN1A; HGS; gag; gag-pol; GRB2; CDS2; ZFYVE9; VCP; VPS37B; WDR12; XPO1; UBD; ARRDC1; KCNN4; RAB11F
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-TSG101 (ARP38773_T100) antibody is Catalog # AAP38773 (Previous Catalog # AAPP20978)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TSG101
• Uniprot ID: Q99816
• Protein Name: Tumor susceptibility gene 101 protein
• Sample Type Confirmation:

  TSG101 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_006283
• Purification: Protein A purified
• Nucleotide Accession #: NM_006292
• Tested Species Reactivity: Human, Rat
• Gene Symbol: TSG101
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Rat Brain
  
  Host: Rat
  Target Name: TSG101
  Sample Tissue: Rat Brain
  Antibody Dilution: 1ug/ml