POU4F1 Antibody - C-terminal region (ARP38763_T100)

Data Sheet
 
Product Number ARP38763_T100
Product Page www.avivasysbio.com/pou4f1-antibody-c-terminal-region-arp38763-t100.html
Name POU4F1 Antibody - C-terminal region (ARP38763_T100)
Protein Size (# AA) 420 amino acids
Molecular Weight 43kDa
NCBI Gene Id 5457
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name POU class 4 homeobox 1
Alias Symbols BRN3A, RDC-1, Oct-T1, brn-3A
Peptide Sequence Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ndisang,D., (2006) Oncogene 25 (1), 51-60
Description of Target POU4F1 is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages.BRN3A (POU4F1) is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages (Gerrero et al., 1993).[supplied by OMIM].
Protein Interactions RIT2; EWSR1; ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POU4F1 (ARP38763_T100) antibody
Blocking Peptide For anti-POU4F1 (ARP38763_T100) antibody is Catalog # AAP38763 (Previous Catalog # AAPS04511)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human POU4F1
Uniprot ID Q01851
Protein Name POU domain, class 4, transcription factor 1
Protein Accession # NP_006228
Purification Protein A purified
Nucleotide Accession # NM_006237
Tested Species Reactivity Human
Gene Symbol POU4F1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: POU4F1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com