Product Number |
ARP38763_T100 |
Product Page |
www.avivasysbio.com/pou4f1-antibody-c-terminal-region-arp38763-t100.html |
Name |
POU4F1 Antibody - C-terminal region (ARP38763_T100) |
Protein Size (# AA) |
420 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
5457 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
POU class 4 homeobox 1 |
Alias Symbols |
BRN3A, RDC-1, Oct-T1, brn-3A |
Peptide Sequence |
Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ndisang,D., (2006) Oncogene 25 (1), 51-60 |
Description of Target |
POU4F1 is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages.BRN3A (POU4F1) is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages (Gerrero et al., 1993).[supplied by OMIM]. |
Protein Interactions |
RIT2; EWSR1; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-POU4F1 (ARP38763_T100) antibody |
Blocking Peptide |
For anti-POU4F1 (ARP38763_T100) antibody is Catalog # AAP38763 (Previous Catalog # AAPS04511) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human POU4F1 |
Uniprot ID |
Q01851 |
Protein Name |
POU domain, class 4, transcription factor 1 |
Protein Accession # |
NP_006228 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006237 |
Tested Species Reactivity |
Human |
Gene Symbol |
POU4F1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Fetal Lung
| Host: Rabbit Target Name: POU4F1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
|