| Product Number |
ARP38732_T100 |
| Product Page |
www.avivasysbio.com/kbtbd10-antibody-n-terminal-region-arp38732-t100.html |
| Name |
KBTBD10 Antibody - N-terminal region (ARP38732_T100) |
| Protein Size (# AA) |
606 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
10324 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kelch repeat and BTB (POZ) domain containing 10 |
| Description |
|
| Alias Symbols |
Krp1, KBTBD10, SARCOSIN |
| Peptide Sequence |
Synthetic peptide located within the following region: MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lim,D.S., et al., (2001) J. Am. Coll. Cardiol. 38 (4), 1175-1180 |
| Description of Target |
KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM. |
| Protein Interactions |
RCHY1; SLC2A4; UBC; RBX1; CUL3; NRAP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLHL41 (ARP38732_T100) antibody |
| Blocking Peptide |
For anti-KLHL41 (ARP38732_T100) antibody is Catalog # AAP38732 (Previous Catalog # AAPP20938) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KBTBD10 |
| Uniprot ID |
O60662 |
| Protein Name |
Kelch repeat and BTB domain-containing protein 10 |
| Publications |
A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome. Skelet Muscle. 3, 3 (2013). 23414517
du Puy, L. et al. Sarcosin (Krp1) in skeletal muscle differentiation: gene expression profiling and knockdown experiments. Int. J. Dev. Biol. 56, 301-9 (2012). 22562206 |
| Protein Accession # |
NP_006054 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006063 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLHL41 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-KBTBD10 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle |
|
