MEOX2 Antibody - N-terminal region (ARP38700_T100)

Data Sheet
 
Product Number ARP38700_T100
Product Page www.avivasysbio.com/meox2-antibody-n-terminal-region-arp38700-t100.html
Name MEOX2 Antibody - N-terminal region (ARP38700_T100)
Protein Size (# AA) 303 amino acids
Molecular Weight 33kDa
NCBI Gene Id 4223
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Mesenchyme homeobox 2
Alias Symbols GAX, MOX2
Peptide Sequence Synthetic peptide located within the following region: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Description of Target MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions ZNF564; ZNF483; TTC39B; LOC153684; ZMAT2; ZNF417; KRT80; DYNLL2; ZNF572; AHSA2; HEXIM2; MSI2; CIB3; MRFAP1L1; IGFN1; TRIM41; KLC4; FBF1; KRTAP4-2; KRTAP4-7; MUM1; ZNF587; PGBD1; EIF1AD; HDHD2; NCALD; KRTAP9-2; TTC25; ADAMTS12; DOCK8; ZNF329; SCNM1; RMND5A
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MEOX2 (ARP38700_T100) antibody
Blocking Peptide For anti-MEOX2 (ARP38700_T100) antibody is Catalog # AAP38700 (Previous Catalog # AAPP20889)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MEOX2
Uniprot ID P50222
Protein Name Homeobox protein MOX-2
Protein Accession # NP_005915
Purification Protein A purified
Nucleotide Accession # NM_005924
Tested Species Reactivity Human
Gene Symbol MEOX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-MEOX2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com