SMAD1 Antibody - C-terminal region (ARP38693_T100)

• Product Number: ARP38693_T100
• Name: SMAD1 Antibody - C-terminal region (ARP38693_T100)
• Protein Size (# AA): 465 amino acids
• Molecular Weight: 65 kDa
• NCBI Gene Id: 4086
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: SMAD family member 1
• Alias Symbols: BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1
• Peptide Sequence: Synthetic peptide located within the following region: FVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jadlowiec,J.A., et al., (2006) J. Biol. Chem. 281 (9), 5341-5347
• Description of Target: SMAD1 belongs to the SMAD family. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. SMAD1 mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, SMAD1 can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of SMAD1 forms a complex with SMAD4, which is important for its function in the transcription regulation. SMAD1 is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation.The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed.
• Protein Interactions: HDAC1; SMURF1; WDR77; AR; UBC; ACVRL1; SMAD4; LEMD3; MAPK1; GSK3B; ZNF521; ZNF423; AKR1B1; AP2A2; PIAS4; ZDHHC3; HBP1; IRF2BP1; SF3B1; MGA; ZNF510; ICK; GMEB1; ZEB2; PUM1; PIGQ; PIAS1; TTF2; KMT2D; ZNF76; XPC; TTF1; SOX5; SNRNP70; SMAD3; SMAD2; SMAD1; INP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Specificity: Expected to react with SMAD1 and SMAD9 (100% homology) and SMAD5 (93% homology).
• Blocking Peptide: For anti-SMAD1 (ARP38693_T100) antibody is Catalog # AAP38693 (Previous Catalog # AAPP20882)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SMAD1
• Uniprot ID: Q15797
• Protein Name: Mothers against decapentaplegic homolog 1
• Protein Accession #: NP_005891
• Purification: Protein A purified
• Nucleotide Accession #: NM_005900
• Tested Species Reactivity: Human
• Gene Symbol: SMAD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human lung, 293T
  
  Host: Rabbit
  Target: SMAD1
  Positive control (+): Human lung (LU)
  Negative control (-): 293T (2T)
  Antibody concentration: 1ug/ml
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 65 kDa isoform is identified.