website statistics
Product Datasheet: ARP38677_T100 - AKAP9 antibody - N-terminal region (ARP38677_T100) - Aviva Systems Biology
 
AKAP9 antibody - N-terminal region (ARP38677_T100)
Data Sheet
 
Product Number ARP38677_T100
Product Page www.avivasysbio.com/akap9-antibody-n-terminal-region-arp38677-t100.html
Product Name AKAP9 antibody - N-terminal region (ARP38677_T100)
Size 100 ul
Gene Symbol AKAP9
Alias Symbols PRKA9, AKAP-9, CG-NAP, YOTIAO, AKAP350, AKAP450, PPP1R45, HYPERION, MU-RMS-40.16A
Protein Size (# AA) 314 amino acids
Molecular Weight 36kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10142
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name A kinase (PRKA) anchor protein (yotiao) 9
Description This is a rabbit polyclonal antibody against AKAP9. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS
Target Reference Larocca,M.C., (2006) Eur. J. Cell Biol. 85 (7), 611-619
Description of Target The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP9 is a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways.
Protein Interactions SAMD3; C1orf94; USHBP1; PRDM14; THAP1; WAC; IKZF3; MAGED1; USO1; BLZF1; SSX2; HNRNPM; MAGEA6; UBC; SUZ12; RNF2; BMI1; SUV39H2; KDM1A; RASSF2; GSK3A; PCNT; PRKACB; PRKACA; CDK5RAP2; gag-pol; TDP2; TSG101; CEBPA; CCNE1; DISC1; TNIK; CDC5L; PMS1; PPP1CA; GRI
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-AKAP9 (ARP38677_T100) antibody is Catalog # AAP38677 (Previous Catalog # AAPP20866)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AKAP9
Complete computational species homology data Anti-AKAP9 (ARP38677_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AKAP9.
Swissprot Id Q6PJH3
Protein Name A kinase (PRKA) anchor protein (Yotiao) 9, isoform CRA_c EMBL EAW76862.1
Sample Type Confirmation

There is BioGPS gene expression data showing that AKAP9 is expressed in Jurkat

Protein Accession # AAH15533
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AKAP9.
Nucleotide Accession # NM_005751
Replacement Item This antibody may replace item sc-136177 from Santa Cruz Biotechnology.
Conjugation Options

ARP38677_T100-FITC Conjugated

ARP38677_T100-HRP Conjugated

ARP38677_T100-Biotin Conjugated

CB Replacement sc-136177; sc-34382; sc-34384; sc-45364; sc-45365; sc-517030
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-AKAP9 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate

There is BioGPS gene expression data showing that AKAP9 is expressed in Jurkat

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com