ZNF263 Antibody - middle region (ARP38674_P050)

Data Sheet
 
Product Number ARP38674_P050
Product Page www.avivasysbio.com/znf263-antibody-middle-region-arp38674-p050.html
Name ZNF263 Antibody - middle region (ARP38674_P050)
Protein Size (# AA) 683 amino acids
Molecular Weight 77kDa
NCBI Gene Id 10127
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 263
Alias Symbols FPM315, ZSCAN44, ZKSCAN12
Peptide Sequence Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Martin,J., (2004) Nature 432 (7020), 988-994
Description of Target ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptional repressor.
Protein Interactions GPATCH2L; FAM115A; CLK3; CLK2; ZSCAN1; PCBD1; TRIM41; SCAND1; PLEKHF2; NME7; SPG21; ZNF446; SUFU; EFEMP2; DVL2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF263 (ARP38674_P050) antibody
Blocking Peptide For anti-ZNF263 (ARP38674_P050) antibody is Catalog # AAP38674 (Previous Catalog # AAPP20863)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF263
Uniprot ID O14978
Protein Name Zinc finger protein 263
Protein Accession # NP_005732
Purification Affinity Purified
Nucleotide Accession # NM_005741
Tested Species Reactivity Human
Gene Symbol ZNF263
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human Liver
WB Suggested Anti-ZNF263 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com