Product Number |
ARP38672_T100 |
Product Page |
www.avivasysbio.com/tsfm-antibody-c-terminal-region-arp38672-t100.html |
Name |
TSFM Antibody - C-terminal region (ARP38672_T100) |
Protein Size (# AA) |
346 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
10102 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ts translation elongation factor, mitochondrial |
Alias Symbols |
EFTS, EFTSMT |
Peptide Sequence |
Synthetic peptide located within the following region: VVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Vernon,J.L., et al., (2000) Cytogenet. Cell Genet. 89 (3-4), 145-146 |
Description of Target |
TSFM associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome. TSFM localizes in mitochondrion. |
Protein Interactions |
UBC; SUMO2; LIG4; C1QBP; MRRF; ACOT13; CDV3; MTRNR2L1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TSFM (ARP38672_T100) antibody |
Blocking Peptide |
For anti-TSFM (ARP38672_T100) antibody is Catalog # AAP38672 (Previous Catalog # AAPP20861) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TSFM |
Uniprot ID |
P43897-2 |
Protein Name |
Elongation factor Ts, mitochondrial |
Sample Type Confirmation |
There is BioGPS gene expression data showing that TSFM is expressed in Jurkat |
Protein Accession # |
NP_005717 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005726 |
Tested Species Reactivity |
Human |
Gene Symbol |
TSFM |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-TSFM Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TSFM is expressed in Jurkat |
|