KLF10 Antibody - N-terminal region (ARP38662_T100)

• Product Number: ARP38662_T100
• Name: KLF10 Antibody - N-terminal region (ARP38662_T100)
• Protein Size (# AA): 480 amino acids
• Molecular Weight: 53kDa
• NCBI Gene Id: 7071
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Kruppel-like factor 10
• Alias Symbols: EGRA, TIEG, TIEG1, EGR-alpha
• Peptide Sequence: Synthetic peptide located within the following region: MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Reinholz,M.M., et al., (2004) Breast Cancer Res. Treat. 86 (1), 75-88
• Description of Target: KLF10 is a transcriptional repressor involved in the regulation of cell growth. KLF10 binds to the consensus sequence 5'-GGTGTG-3'.
• Protein Interactions: ZNF512B; CDK6; ITCH; UBC; SIAH1; TYK2; RPL14; LRRC75A-AS1; LENG1; SF3B3; BOP1; TNS1; PIGC; CRIP2; KDM5B; SP1; SIN3A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KLF10 (ARP38662_T100) antibody is Catalog # AAP38662 (Previous Catalog # AAPP20852)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF10
• Uniprot ID: Q13118
• Protein Name: Krueppel-like factor 10
• Protein Accession #: NP_005646
• Purification: Protein A purified
• Nucleotide Accession #: NM_005655
• Tested Species Reactivity: Human
• Gene Symbol: KLF10
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 92%; Rabbit: 85%; Rat: 82%
• Image 1: Human Placenta
  
  WB Suggested Anti-KLF10 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta