SOX3 antibody - N-terminal region (ARP38648_T100)
Data Sheet
Product Number ARP38648_T100
Product Page
Product Name SOX3 antibody - N-terminal region (ARP38648_T100)
Size 100 ul
Gene Symbol SOX3
Protein Size (# AA) 446 amino acids
Molecular Weight 45kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6658
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name SRY (sex determining region Y)-box 3
Description This is a rabbit polyclonal antibody against SOX3. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGL
Target Reference Savare,J., et al., (2005) Mol. Biol. Cell 16 (6), 2660-2669
Description of Target SOX3 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.
Protein Interactions TRRAP; SUMO1; SUMO2; PAX6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SOX3 (ARP38648_T100) antibody is Catalog # AAP38648 (Previous Catalog # AAPP20838)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SOX3
Complete computational species homology data Anti-SOX3 (ARP38648_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SOX3.
Swissprot Id P41225
Protein Name Transcription factor SOX-3
Sample Type Confirmation

SOX3 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_005625
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SOX3.
Nucleotide Accession # NM_005634
Replacement Item This antibody may replace item sc-101155 from Santa Cruz Biotechnology.
Conjugation Options

ARP38648_T100-FITC Conjugated

ARP38648_T100-HRP Conjugated

ARP38648_T100-Biotin Conjugated

CB Replacement sc-101155; sc-134023; sc-17324; sc-20089; sc-8233
Species Reactivity Human, Mouse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 85%; Pig: 93%
Image 1
Human MCF-7
WB Suggested Anti-SOX3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

SOX3 is supported by BioGPS gene expression data to be expressed in MCF7


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |