GSCL Antibody - C-terminal region (ARP38599_T100)

• Product Number: ARP38599_T100
• Name: GSCL Antibody - C-terminal region (ARP38599_T100)
• Protein Size (# AA): 205 amino acids
• Molecular Weight: 22kDa
• NCBI Gene Id: 2928
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Goosecoid homeobox 2
• Alias Symbols: GSCL
• Peptide Sequence: Synthetic peptide located within the following region: LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASAS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Galili,N., (2000) Dev. Dyn. 218 (1), 102-111
• Description of Target: Goosecoidlike (GSCL) resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology.Goosecoidlike (GSCL), a homeodomain-containing gene, resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is a developmental disorder characterized by conotruncal heart defects, craniofacial anomalies, and learning disabilities. VCFS is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology. The gene is expressed in a limited number of adult tissues, as well as in early human development.
• Protein Interactions: RNF4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GSC2 (ARP38599_T100) antibody is Catalog # AAP38599 (Previous Catalog # AAPS04412)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSCL
• Uniprot ID: O15499
• Protein Name: Homeobox protein goosecoid-2
• Protein Accession #: NP_005306
• Purification: Protein A purified
• Nucleotide Accession #: NM_005315
• Tested Species Reactivity: Human
• Gene Symbol: GSC2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 91%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-GSCL Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysate