website statistics
Product Datasheet: ARP38595_T100 - FOXG1B antibody - N-terminal region (ARP38595_T100) - Aviva Systems Biology
FOXG1B antibody - N-terminal region (ARP38595_T100)
Data Sheet
Product Number ARP38595_T100
Product Page
Product Name FOXG1B antibody - N-terminal region (ARP38595_T100)
Size 100 ul
Gene Symbol FOXG1
Alias Symbols BF1, BF2, QIN, FKH2, HBF2, HFK1, HFK2, HFK3, KHL2, FHKL3, FKHL1, FKHL2, FKHL3, FKHL4, HBF-1, HBF-2, HBF-3, FOXG1A, FOXG1B, FOXG1C, HBF-G2
Protein Size (# AA) 489 amino acids
Molecular Weight 52kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2290
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Forkhead box G1
Description This is a rabbit polyclonal antibody against FOXG1B. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH
Target Reference Tan,K., (2003) J. Biol. Chem. 278 (23), 20507-20513
Description of Target FOXG1B belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of FOXG1B has not yet been determined; however, it may play a role in the development of the brain and telencephalonThis gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
Protein Interactions APOE; TLE1; TRAF6; KDM5B; FOXH1; EEF1G; SMAD3; FOXO3; GDF9; SMAD1; SMAD2; HDAC1; SMAD4; TLE3; FOXO4; HES1; FOXO1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-FOXG1 (ARP38595_T100) antibody is Catalog # AAP38595 (Previous Catalog # AAPS04411)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXG1B
Complete computational species homology data Anti-FOXG1B (ARP38595_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXG1B.
Swissprot Id Q86XT7
Protein Name Forkhead box protein G1
Protein Accession # NP_005240
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXG1B.
Nucleotide Accession # NM_005249
Replacement Item This antibody may replace item sc-130975 from Santa Cruz Biotechnology.
Conjugation Options

ARP38595_T100-FITC Conjugated

ARP38595_T100-HRP Conjugated

ARP38595_T100-Biotin Conjugated

CB Replacement sc-130975; sc-18581; sc-18583; sc-43631; sc-48788
Species Reactivity Human, Mouse, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-FOXG1B Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |