FOXG1B Antibody - N-terminal region (ARP38595_T100)

Data Sheet
 
Product Number ARP38595_T100
Product Page www.avivasysbio.com/foxg1b-antibody-n-terminal-region-arp38595-t100.html
Name FOXG1B Antibody - N-terminal region (ARP38595_T100)
Protein Size (# AA) 489 amino acids
Molecular Weight 52kDa
NCBI Gene Id 2290
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box G1
Alias Symbols BF1, BF2, QIN, FKH2, HBF2, HFK1, HFK2, HFK3, KHL2, FHKL3, FKHL1, FKHL2, FKHL3, FKHL4, HBF-1, HBF-2, HBF-3, FOXG1A, FOXG1B, FOXG1C, HBF-G2
Peptide Sequence Synthetic peptide located within the following region: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tan,K., (2003) J. Biol. Chem. 278 (23), 20507-20513
Description of Target FOXG1B belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of FOXG1B has not yet been determined; however, it may play a role in the development of the brain and telencephalonThis gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
Protein Interactions APOE; TLE1; TRAF6; KDM5B; FOXH1; EEF1G; SMAD3; FOXO3; GDF9; SMAD1; SMAD2; HDAC1; SMAD4; TLE3; FOXO4; HES1; FOXO1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXG1 (ARP38595_T100) antibody
Blocking Peptide For anti-FOXG1 (ARP38595_T100) antibody is Catalog # AAP38595 (Previous Catalog # AAPS04411)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXG1B
Uniprot ID Q86XT7
Protein Name Forkhead box protein G1
Protein Accession # NP_005240
Purification Protein A purified
Nucleotide Accession # NM_005249
Tested Species Reactivity Human
Gene Symbol FOXG1
Predicted Species Reactivity Human, Mouse, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-FOXG1B Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com