Product Number |
ARP38590_P050 |
Product Page |
www.avivasysbio.com/elk3-antibody-n-terminal-region-arp38590-p050.html |
Name |
Elk3 Antibody - N-terminal region (ARP38590_P050) |
Protein Size (# AA) |
409 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
13713 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ELK3, member of ETS oncogene family |
Alias Symbols |
E, Ne, Sa, Erp, Net, Etrp, Sap-2, D430049E23Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Elk3 remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Elk3 (ARP38590_P050) antibody |
Blocking Peptide |
For anti-Elk3 (ARP38590_P050) antibody is Catalog # AAP38590 (Previous Catalog # AAPP20780) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P41971 |
Protein Name |
ETS domain-containing protein Elk-3 |
Protein Accession # |
NP_038536 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013508 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Elk3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Image 1 | Mouse Small Intestine
| WB Suggested Anti-Elk3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Mouse Small Intestine |
|
|