ELK1 Antibody - N-terminal region (ARP38589_T100)

Data Sheet
 
Product Number ARP38589_T100
Product Page www.avivasysbio.com/elk1-antibody-n-terminal-region-arp38589-t100.html
Name ELK1 Antibody - N-terminal region (ARP38589_T100)
Protein Size (# AA) 428 amino acids
Molecular Weight 45kDa
NCBI Gene Id 2002
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name ELK1, member of ETS oncogene family
Peptide Sequence Synthetic peptide located within the following region: MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hsieh,Y.H., et al., (2006) Biochem. Biophys. Res. Commun. 339 (1), 217-225
Description of Target ELK1 is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade.This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade.
Protein Interactions SUMO1; UBE2I; FBXO25; UBC; SRF; ELK1; MAPK3; MAPK1; STARD3NL; MAPK9; MAPK8; CDK6; MAPK10; APP; SNCA; MAD2L2; PADI4; ELAVL1; Sin3a; HDAC1; HOXB13; KLF4; EMX1; TAOK2; MOB4; ID1; PIAS2; STK16; MAPK11; EP300; MAP2K3; GRB10; ID2; MAPK14; ID3; CREBBP; CEBPB; MA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ELK1 (ARP38589_T100) antibody
Blocking Peptide For anti-ELK1 (ARP38589_T100) antibody is Catalog # AAP38589 (Previous Catalog # AAPP20779)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ELK1
Uniprot ID P19419
Protein Name ETS domain-containing protein Elk-1
Sample Type Confirmation

ELK1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005220
Purification Protein A purified
Nucleotide Accession # NM_005229
Tested Species Reactivity Human
Gene Symbol ELK1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Placenta
Rabbit Anti-ELK1 antibody
Catalog Number: ARP38589_T100
Paraffin Embedded Tissue: Human Placenta cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-ELK1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateELK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com