| Product Number |
ARP38536_T100 |
| Product Page |
www.avivasysbio.com/mds1-antibody-n-terminal-region-arp38536-t100.html |
| Name |
MDS1 Antibody - N-terminal region (ARP38536_T100) |
| Protein Size (# AA) |
169 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
4197 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Myelodysplasia syndrome 1 |
| Alias Symbols |
PRDM3, MDS1-EVI1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fears,S., et al., (1996) Proc. Natl. Acad. Sci. U.S.A. 93 (4), 1642-1647 |
| Description of Target |
MDS1 is located at 3q26 170-400 kb upstream (telomeric) of EVI1 in the chromosomal region in which some of the breakpoints 5' of EVI1 have been mapped. MDS1 has been identified as a single gene as well as a previously unreported exon(s) of EVI1. MDS1 exists in normal tissues both as a unique transcript and as a normal fusion transcript with EVI1, with an additional 188 codons at the 5' end of the previously reported EVI1 open reading frame. In cells with translocation t (3;21), additional fusion transcripts are AML1-MDS1 and AML1-MDS1-EVI1. EVI1 and MDS1 are involved in leukemia associated with chromosomal translocation breakpoints in the region between these genes. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MDS1 (ARP38536_T100) antibody |
| Blocking Peptide |
For anti-MDS1 (ARP38536_T100) antibody is Catalog # AAP38536 (Previous Catalog # AAPP20727) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MDS1 |
| Uniprot ID |
Q13465 |
| Protein Name |
MDS1 and EVI1 complex locus protein MDS1 |
| Protein Accession # |
NP_004982 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004991 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MDS1 |
| Predicted Species Reactivity |
Human, Mouse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 93%; Zebrafish: 77% |
| Image 1 | Human Raji
 | WB Suggested Anti-MDS1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Raji cell lysate |
|
|
