Product Number |
ARP38503_T100 |
Product Page |
www.avivasysbio.com/tcf15-antibody-n-terminal-region-arp38503-t100.html |
Name |
TCF15 Antibody - N-terminal region (ARP38503_T100) |
Protein Size (# AA) |
199 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
6939 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transcription factor 15 (basic helix-loop-helix) |
Alias Symbols |
EC2, PARAXIS, bHLHa40 |
Peptide Sequence |
Synthetic peptide located within the following region: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hidai,H., (1995) Genomics 30 (3), 598-601 |
Description of Target |
TCF15 is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding. |
Protein Interactions |
RAD21; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TCF15 (ARP38503_T100) antibody |
Blocking Peptide |
For anti-TCF15 (ARP38503_T100) antibody is Catalog # AAP38503 (Previous Catalog # AAPP23405) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF15 |
Uniprot ID |
Q12870 |
Protein Name |
Transcription factor 15 |
Protein Accession # |
NP_004600 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004609 |
Tested Species Reactivity |
Human |
Gene Symbol |
TCF15 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Image 1 | Human Jurkat
| WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysate |
|
|