TCF15 Antibody - N-terminal region (ARP38503_T100)

Data Sheet
 
Product Number ARP38503_T100
Product Page www.avivasysbio.com/tcf15-antibody-n-terminal-region-arp38503-t100.html
Name TCF15 Antibody - N-terminal region (ARP38503_T100)
Protein Size (# AA) 199 amino acids
Molecular Weight 21kDa
NCBI Gene Id 6939
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transcription factor 15 (basic helix-loop-helix)
Alias Symbols EC2, PARAXIS, bHLHa40
Peptide Sequence Synthetic peptide located within the following region: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hidai,H., (1995) Genomics 30 (3), 598-601
Description of Target TCF15 is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.
Protein Interactions RAD21;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF15 (ARP38503_T100) antibody
Blocking Peptide For anti-TCF15 (ARP38503_T100) antibody is Catalog # AAP38503 (Previous Catalog # AAPP23405)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF15
Uniprot ID Q12870
Protein Name Transcription factor 15
Protein Accession # NP_004600
Purification Protein A purified
Nucleotide Accession # NM_004609
Tested Species Reactivity Human
Gene Symbol TCF15
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Jurkat
WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com