Product Number |
ARP38501_P050 |
Product Page |
www.avivasysbio.com/pou4f2-antibody-n-terminal-region-arp38501-p050.html |
Name |
POU4F2 Antibody - N-terminal region (ARP38501_P050) |
Protein Size (# AA) |
410 amino acids |
Molecular Weight |
43 kDa |
NCBI Gene Id |
5458 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
POU class 4 homeobox 2 |
Alias Symbols |
BRN3B, BRN3.2, Brn-3b |
Peptide Sequence |
Synthetic peptide located within the following region: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Samady,L., (2006) Int. J. Cancer 118 (4), 869-878 |
Description of Target |
POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM]. |
Protein Interactions |
ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-POU4F2 (ARP38501_P050) antibody |
Blocking Peptide |
For anti-POU4F2 (ARP38501_P050) antibody is Catalog # AAP38501 (Previous Catalog # AAPS04311) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human POU4F2 |
Uniprot ID |
Q12837 |
Protein Name |
POU domain, class 4, transcription factor 2 |
Publications |
Tucker, B. A., Anfinson, K. R., Mullins, R. F., Stone, E. M. & Young, M. J. Use of a synthetic xeno-free culture substrate for induced pluripotent stem cell induction and retinal differentiation. Stem Cells Transl. Med. 2, 16-24 (2013). 23283489 |
Protein Accession # |
NP_004566 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004575 |
Tested Species Reactivity |
Human |
Gene Symbol |
POU4F2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93% |
Image 1 | Human OVCAR-3 Whole Cell
| Host: Rabbit Target Name: POU4F2 Sample Tissue: Human OVCAR-3 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human Fetal Liver
| Host: Rabbit Target Name: POU4F2 Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|