POU4F2 Antibody - N-terminal region (ARP38501_P050)

Data Sheet
 
Product Number ARP38501_P050
Product Page www.avivasysbio.com/pou4f2-antibody-n-terminal-region-arp38501-p050.html
Name POU4F2 Antibody - N-terminal region (ARP38501_P050)
Protein Size (# AA) 410 amino acids
Molecular Weight 43 kDa
NCBI Gene Id 5458
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name POU class 4 homeobox 2
Alias Symbols BRN3B, BRN3.2, Brn-3b
Peptide Sequence Synthetic peptide located within the following region: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Samady,L., (2006) Int. J. Cancer 118 (4), 869-878
Description of Target POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM].
Protein Interactions ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-POU4F2 (ARP38501_P050) antibody
Blocking Peptide For anti-POU4F2 (ARP38501_P050) antibody is Catalog # AAP38501 (Previous Catalog # AAPS04311)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human POU4F2
Uniprot ID Q12837
Protein Name POU domain, class 4, transcription factor 2
Publications

Tucker, B. A., Anfinson, K. R., Mullins, R. F., Stone, E. M. & Young, M. J. Use of a synthetic xeno-free culture substrate for induced pluripotent stem cell induction and retinal differentiation. Stem Cells Transl. Med. 2, 16-24 (2013). 23283489

Protein Accession # NP_004566
Purification Affinity Purified
Nucleotide Accession # NM_004575
Tested Species Reactivity Human
Gene Symbol POU4F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93%
Image 1
Human OVCAR-3 Whole Cell
Host: Rabbit
Target Name: POU4F2
Sample Tissue: Human OVCAR-3 Whole Cell
Antibody Dilution: 1ug/ml
Image 2
Human Fetal Liver
Host: Rabbit
Target Name: POU4F2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com