RNF14 Antibody - C-terminal region (ARP38448_T100)

Data Sheet
 
Product Number ARP38448_T100
Product Page www.avivasysbio.com/rnf14-antibody-c-terminal-region-arp38448-t100.html
Name RNF14 Antibody - C-terminal region (ARP38448_T100)
Protein Size (# AA) 474 amino acids
Molecular Weight 52kDa
NCBI Gene Id 9604
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ring finger protein 14
Alias Symbols ARA54, HFB30, TRIAD2, HRIHFB2038
Peptide Sequence Synthetic peptide located within the following region: CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lin,D.Y., (2004) Mol. Cell. Biol. 24 (24), 10529-10541
Description of Target RNF14 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Protein Interactions UBE2E2; UBE2D1; DACH1; UBE2D4; LEF1; TCF3; HNF1A; TCF4; CTNNB1; UBC; AR; FAM46A; TNFAIP3; ECT2; UBE2E3; UBE2E1; PHF7; TAGLN; HNRNPA1; VDR; UBE2D3; UBE2D2; UBE2U; UBE2W; UBE2V1; NCOA4; NR3C1; ESR1; RNF14;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF14 (ARP38448_T100) antibody
Blocking Peptide For anti-RNF14 (ARP38448_T100) antibody is Catalog # AAP38448 (Previous Catalog # AAPP23161)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14
Uniprot ID Q9UBS8
Protein Name E3 ubiquitin-protein ligase RNF14
Protein Accession # NP_899648
Purification Protein A purified
Nucleotide Accession # NM_183401
Tested Species Reactivity Human
Gene Symbol RNF14
Predicted Species Reactivity Human, Rat, Cow, Dog, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Human: 100%; Rabbit: 79%; Rat: 79%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-RNF14 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com