Product Number |
ARP38425_T100 |
Product Page |
www.avivasysbio.com/znf213-antibody-n-terminal-region-arp38425-t100.html |
Name |
ZNF213 Antibody - N-terminal region (ARP38425_T100) |
Protein Size (# AA) |
459 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
7760 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 213 |
Alias Symbols |
CR53, ZSCAN53, ZKSCAN21 |
Peptide Sequence |
Synthetic peptide located within the following region: MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chen,X., et al., (1999) Biochim. Biophys. Acta 1444 (2), 218-230 |
Description of Target |
ZNF213 contains three C2H2 zinc fingers, a Kruppel associated A box and a leucine rich motif (LeR domain/SCAN box), strongly suggestive of a transcription factor.C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM]. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF213 (ARP38425_T100) antibody |
Blocking Peptide |
For anti-ZNF213 (ARP38425_T100) antibody is Catalog # AAP38425 (Previous Catalog # AAPP20614) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF213 |
Uniprot ID |
O14771 |
Protein Name |
Zinc finger protein 213 |
Protein Accession # |
NP_004211 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004220 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF213 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF213 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|