ZNF213 Antibody - N-terminal region (ARP38425_T100)

Data Sheet
 
Product Number ARP38425_T100
Product Page www.avivasysbio.com/znf213-antibody-n-terminal-region-arp38425-t100.html
Name ZNF213 Antibody - N-terminal region (ARP38425_T100)
Protein Size (# AA) 459 amino acids
Molecular Weight 51kDa
NCBI Gene Id 7760
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 213
Alias Symbols CR53, ZSCAN53, ZKSCAN21
Peptide Sequence Synthetic peptide located within the following region: MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen,X., et al., (1999) Biochim. Biophys. Acta 1444 (2), 218-230
Description of Target ZNF213 contains three C2H2 zinc fingers, a Kruppel associated A box and a leucine rich motif (LeR domain/SCAN box), strongly suggestive of a transcription factor.C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM].
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF213 (ARP38425_T100) antibody
Blocking Peptide For anti-ZNF213 (ARP38425_T100) antibody is Catalog # AAP38425 (Previous Catalog # AAPP20614)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF213
Uniprot ID O14771
Protein Name Zinc finger protein 213
Protein Accession # NP_004211
Purification Protein A purified
Nucleotide Accession # NM_004220
Tested Species Reactivity Human
Gene Symbol ZNF213
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF213 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com