E2F2 Antibody - middle region (ARP38418_P050)

Data Sheet
 
Product Number ARP38418_P050
Product Page www.avivasysbio.com/e2f2-antibody-middle-region-arp38418-p050.html
Name E2F2 Antibody - middle region (ARP38418_P050)
Protein Size (# AA) 437 amino acids
Molecular Weight 48 kDa
NCBI Gene Id 1870
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name E2F transcription factor 2
Alias Symbols E2F-2
Peptide Sequence Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Raj,D., (2008) Carcinogenesis 29 (1), 194-201
Description of Target E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions RB1; GNB5; GIT2; TFDP1; RBL1; ARID3A; ELAVL1; ATAD2; KMT2D; KMT2A; RYBP; SETD8; BCAR1; TFDP2; BRD2; YY1; SP1; CDK3; RNF144A; FHL2; SPIB; RBL2; E2F4; MYBL2; EAPP; TP53BP2; PPP1R13B; TP53INP1; JMY; GAB2; CDC25A; CDC6; E2F1; UXT; MT1G;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-E2F2 (ARP38418_P050) antibody
Blocking Peptide For anti-E2F2 (ARP38418_P050) antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human E2F2
Uniprot ID Q14209
Protein Name Transcription factor E2F2
Protein Accession # NP_004082
Purification Affinity Purified
Nucleotide Accession # NM_004091
Tested Species Reactivity Human, Mouse
Gene Symbol E2F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Image 1
Human brain
WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Image 2
Human Brain
Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-E2F2 antibody (ARP38418_P050)
Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com