BUD31 Antibody - middle region (ARP38402_T100)

Data Sheet
 
Product Number ARP38402_T100
Product Page www.avivasysbio.com/bud31-antibody-middle-region-arp38402-t100.html
Name BUD31 Antibody - middle region (ARP38402_T100)
Protein Size (# AA) 144 amino acids
Molecular Weight 17kDa
NCBI Gene Id 8896
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name BUD31 homolog (S. cerevisiae)
Alias Symbols G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W
Peptide Sequence Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
Description of Target BUD31 may be a nuclear regulator of transcription.
Protein Interactions KRTAP10-3; KRTAP10-7; BEND5; UBC; BMI1; CTNNBL1; RELB; ADCY7; TPBG; SON; SRSF7; SRSF3; RPS7; SEPT7; APP; ZNF326; ZC3H18; TRIM55; TRA2A; UTP14A; VTN; TPR; KIAA0101;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BUD31 (ARP38402_T100) antibody
Blocking Peptide For anti-BUD31 (ARP38402_T100) antibody is Catalog # AAP38402 (Previous Catalog # AAPP20588)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BUD31
Uniprot ID P41223
Protein Name Protein BUD31 homolog
Protein Accession # NP_003901
Purification Protein A purified
Nucleotide Accession # NM_003910
Tested Species Reactivity Human
Gene Symbol BUD31
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-BUD31 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com