EED Antibody - N-terminal region (ARP38384_P050)

Data Sheet
 
Product Number ARP38384_P050
Product Page www.avivasysbio.com/eed-antibody-n-terminal-region-arp38384-p050.html
Name EED Antibody - N-terminal region (ARP38384_P050)
Protein Size (# AA) 400 amino acids
Molecular Weight 45kDa
NCBI Gene Id 8726
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Embryonic ectoderm development
Alias Symbols HEED, COGIS, WAIT1
Peptide Sequence Synthetic peptide located within the following region: QKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function.
Protein Interactions PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EED (ARP38384_P050) antibody
Blocking Peptide For anti-EED (ARP38384_P050) antibody is Catalog # AAP38384 (Previous Catalog # AAPP23152)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Uniprot ID O75530-3
Protein Name Polycomb protein EED
Protein Accession # NP_694536
Purification Affinity Purified
Nucleotide Accession # NM_152991
Tested Species Reactivity Human, Mouse
Gene Symbol EED
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
HepG2
Host: Rabbit
Target Name: EED
Sample Type: HepG2
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 4.0ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%
Image 2
Human HepG3
Host: Rabbit
Target Name: EED
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
Image 3
Mouse Kidney
Host: Mouse
Target Name: EED
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com