Product Number |
ARP38360_T100 |
Product Page |
www.avivasysbio.com/znf282-antibody-n-terminal-region-arp38360-t100.html |
Name |
ZNF282 Antibody - N-terminal region (ARP38360_T100) |
Protein Size (# AA) |
671 amino acids |
Molecular Weight |
74kDa |
NCBI Gene Id |
8427 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 282 |
Alias Symbols |
HUB1 |
Peptide Sequence |
Synthetic peptide located within the following region: QQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Cheng,J., (2005) Science 308 (5725), 1149-1154 |
Description of Target |
ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat. |
Protein Interactions |
UBC; SUMO2; MAPKAPK5; PKN1; PIK3CG; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF282 (ARP38360_T100) antibody |
Blocking Peptide |
For anti-ZNF282 (ARP38360_T100) antibody is Catalog # AAP38360 (Previous Catalog # AAPP20547) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF282 |
Uniprot ID |
Q9UDV7 |
Protein Name |
Zinc finger protein 282 |
Protein Accession # |
NP_003566 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003575 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF282 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF282 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|
|