ZNF282 Antibody - N-terminal region (ARP38360_T100)

Data Sheet
 
Product Number ARP38360_T100
Product Page www.avivasysbio.com/znf282-antibody-n-terminal-region-arp38360-t100.html
Name ZNF282 Antibody - N-terminal region (ARP38360_T100)
Protein Size (# AA) 671 amino acids
Molecular Weight 74kDa
NCBI Gene Id 8427
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 282
Alias Symbols HUB1
Peptide Sequence Synthetic peptide located within the following region: QQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cheng,J., (2005) Science 308 (5725), 1149-1154
Description of Target ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat.
Protein Interactions UBC; SUMO2; MAPKAPK5; PKN1; PIK3CG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF282 (ARP38360_T100) antibody
Blocking Peptide For anti-ZNF282 (ARP38360_T100) antibody is Catalog # AAP38360 (Previous Catalog # AAPP20547)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF282
Uniprot ID Q9UDV7
Protein Name Zinc finger protein 282
Protein Accession # NP_003566
Purification Protein A purified
Nucleotide Accession # NM_003575
Tested Species Reactivity Human
Gene Symbol ZNF282
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Transfected 293T
WB Suggested Anti-ZNF282 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com