ZNF124 Antibody - N-terminal region (ARP38327_T100)

• Product Number: ARP38327_T100
• Name: ZNF124 Antibody - N-terminal region (ARP38327_T100)
• Protein Size (# AA): 289 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 7678
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 124
• Alias Symbols: ZK7, HZF16, HZF-16
• Peptide Sequence: Synthetic peptide located within the following region: MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Saleh,M., et al., (1993) Am. J. Hum. Genet. 52 (1), 192-203
• Description of Target: ZNF124 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF124 may be involved in transcriptional regulation.
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-1; KRTAP10-9; KRTAP10-7; KRT40; FSD2; SSX2IP; SYCE1; KRTAP4-2; TSGA10; CCNDBP1; TRAF1; TCF4; MEOX2; MDFI; KRT31; KRTAP5-9; GOLGA2; UBC; Trim28;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF124 (ARP38327_T100) antibody is Catalog # AAP38327 (Previous Catalog # AAPP20514)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF124
• Uniprot ID: Q15973-4
• Protein Name: Zinc finger protein 124
• Protein Accession #: NP_003422
• Purification: Protein A purified
• Nucleotide Accession #: NM_003431
• Tested Species Reactivity: Human
• Gene Symbol: ZNF124
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF124 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate