website statistics
Product Datasheet: ARP38327_T100 - ZNF124 antibody - N-terminal region (ARP38327_T100) - Aviva Systems Biology
ZNF124 antibody - N-terminal region (ARP38327_T100)
Data Sheet
Product Number ARP38327_T100
Product Page
Product Name ZNF124 antibody - N-terminal region (ARP38327_T100)
Size 100 ul
Gene Symbol ZNF124
Alias Symbols ZK7, HZF16, HZF-16
Protein Size (# AA) 289 amino acids
Molecular Weight 33kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 7678
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 124
Description This is a rabbit polyclonal antibody against ZNF124. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLA
Target Reference Saleh,M., et al., (1993) Am. J. Hum. Genet. 52 (1), 192-203
Description of Target ZNF124 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF124 may be involved in transcriptional regulation.
Protein Interactions NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-1; KRTAP10-9; KRTAP10-7; KRT40; FSD2; SSX2IP; SYCE1; KRTAP4-2; TSGA10; CCNDBP1; TRAF1; TCF4; MEOX2; MDFI; KRT31; KRTAP5-9; GOLGA2; UBC; Trim28;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF124 (ARP38327_T100) antibody is Catalog # AAP38327 (Previous Catalog # AAPP20514)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF124
Complete computational species homology data Anti-ZNF124 (ARP38327_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF124.
Swissprot Id Q15973-4
Protein Name Zinc finger protein 124
Protein Accession # NP_003422
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF124.
Nucleotide Accession # NM_003431
Replacement Item This antibody may replace item sc-101078 from Santa Cruz Biotechnology.
Conjugation Options

ARP38327_T100-FITC Conjugated

ARP38327_T100-HRP Conjugated

ARP38327_T100-Biotin Conjugated

CB Replacement sc-101078
Species Reactivity Dog, Horse, Human, Mouse, Pig, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-ZNF124 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |