| Product Number |
ARP38325_T100 |
| Product Page |
www.avivasysbio.com/znf76-antibody-n-terminal-region-arp38325-t100.html |
| Name |
ZNF76 Antibody - N-terminal region (ARP38325_T100) |
| Protein Size (# AA) |
570 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
7629 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 76 |
| Alias Symbols |
ZNF523, Zfp523, D6S229E |
| Peptide Sequence |
Synthetic peptide located within the following region: LSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zheng,G. (2006) Biochem. Biophys. Res. Commun. 339 (4), 1069-1075 |
| Description of Target |
ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF76 is a general transcription repressor targeting TATA-binding protein (TBP), through a process regulated by sumoylation. ZNF76 interacts with TBP through both its N and C termini, and both regions are required for ZNF76 to exert its inhibitory function on p53-mediated transactivation. As a TBP-interacting transcriptional modulator, ZNF76 is also regulated by alternative splicing. |
| Protein Interactions |
SMAD1; UBC; TBP; HDAC1; EP300; CAND1; ELAVL1; Pias1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF76 (ARP38325_T100) antibody |
| Blocking Peptide |
For anti-ZNF76 (ARP38325_T100) antibody is Catalog # AAP38325 (Previous Catalog # AAPP20512) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF76 |
| Uniprot ID |
P36508 |
| Protein Name |
Zinc finger protein 76 |
| Protein Accession # |
NP_003418 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003427 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF76 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF76 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
