TFAP2C Antibody - N-terminal region (ARP38284_T100)

Data Sheet
 
Product Number ARP38284_T100
Product Page www.avivasysbio.com/tfap2c-antibody-n-terminal-region-arp38284-t100.html
Name TFAP2C Antibody - N-terminal region (ARP38284_T100)
Protein Size (# AA) 450 amino acids
Molecular Weight 49kDa
NCBI Gene Id 7022
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Alias Symbols ERF1, TFAP2G, hAP-2g, AP2-GAMMA
Peptide Sequence Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pauls,K., (2005) Int. J. Cancer 115 (3), 470-477
Description of Target TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.
Protein Interactions ZFAND4; NR1I2; IKBKB; GPR22; CCNG1; KCTD1; SUMO1; UBE2I; BRCA1; HHV8GK18_gp81; KDM5B; MYC; ELAVL1; SUMO2; UBC; CITED4; CITED2; CITED1; TP53;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TFAP2C (ARP38284_T100) antibody
Blocking Peptide For anti-TFAP2C (ARP38284_T100) antibody is Catalog # AAP38284 (Previous Catalog # AAPP23123)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2C
Uniprot ID Q92754
Protein Name Transcription factor AP-2 gamma
Protein Accession # NP_003213
Purification Protein A purified
Nucleotide Accession # NM_003222
Tested Species Reactivity Human, Mouse
Gene Symbol TFAP2C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 75%; Horse: 75%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human kidney
Human kidney
Image 2
Transfected 293T
WB Suggested Anti-TFAP2C Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: TFAP2C
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
Mouse Brain
Host: Mouse
Target Name: TFAP2C
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com