Product Number |
ARP38278_P050 |
Product Page |
www.avivasysbio.com/tead3-antibody-c-terminal-region-arp38278-p050.html |
Name |
TEAD3 Antibody - C-terminal region (ARP38278_P050) |
Protein Size (# AA) |
435 amino acids |
Molecular Weight |
49 kDa |
NCBI Gene Id |
7005 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
TEA domain family member 3 |
Alias Symbols |
TEF5, TEAD5, TEF-5, DTEF-1, ETFR-1, TEAD-3 |
Peptide Sequence |
Synthetic peptide located within the following region: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Peng,L., (2004) Mol. Endocrinol. 18 (8), 2049-2060 |
Description of Target |
TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon. |
Protein Interactions |
VGLL2; YAP1; KIFC2; PIDD1; PHB2; AP4S1; UBC; SUMO2; WWTR1; VGLL1; CTBP2; MYH7; E2F3; E2F1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-TEAD3 (ARP38278_P050) antibody |
Blocking Peptide |
For anti-TEAD3 (ARP38278_P050) antibody is Catalog # AAP38278 (Previous Catalog # AAPP23118) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD3 |
Uniprot ID |
Q99594 |
Protein Name |
Transcriptional enhancer factor TEF-5 |
Sample Type Confirmation |
TEAD3 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_003205 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003214 |
Tested Species Reactivity |
Human |
Gene Symbol |
TEAD3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Intestine
| Human Intestine |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. |
|