TCF12 Antibody - N-terminal region (ARP38271_P050)

Data Sheet
 
Product Number ARP38271_P050
Product Page www.avivasysbio.com/tcf12-antibody-n-terminal-region-arp38271-p050.html
Name TCF12 Antibody - N-terminal region (ARP38271_P050)
Protein Size (# AA) 682 amino acids
Molecular Weight 73kDa
NCBI Gene Id 6938
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 12
Alias Symbols HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
Peptide Sequence Synthetic peptide located within the following region: IGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Description of Target TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cell
Protein Interactions TSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF12 (ARP38271_P050) antibody
Blocking Peptide For anti-TCF12 (ARP38271_P050) antibody is Catalog # AAP38271 (Previous Catalog # AAPP20480)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12
Uniprot ID Q99081
Protein Name Transcription factor 12
Sample Type Confirmation

TCF12 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_003196
Purification Affinity Purified
Nucleotide Accession # NM_003205
Tested Species Reactivity Human
Gene Symbol TCF12
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 82%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-TCF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateTCF12 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com