| Product Number |
ARP38267_T100 |
| Product Page |
www.avivasysbio.com/tcf3-antibody-n-terminal-region-arp38267-t100.html |
| Name |
TCF3 Antibody - N-terminal region (ARP38267_T100) |
| Protein Size (# AA) |
654 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
6929 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) |
| Alias Symbols |
E2A, E47, p75, AGM8, ITF1, VDIR, TCF-3, bHLHb21 |
| Peptide Sequence |
Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Maruyama,K. (2005) J. Biol. Chem. 280 (41), 34577-34589 |
| Description of Target |
TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. |
| Protein Interactions |
ID3; FAM115A; TLE1; RNF14; UBC; SCX; MAPKAPK2; MAPKAPK3; TCF21; Ube2i; ID2; FUS; CTNNB1; RPL37; MAX; USF1; TCF12; TCF3; MYOD1; Rufy1; Tfap4; Rpa1; Tbx6; Ncl; Twist2; SUPT3H; TRRAP; KAT2A; TADA2A; FOXH1; ELAVL1; TCF24; SETSIP; FLG2; BHLHA15; MYL6B; TIMM50; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCF3 (ARP38267_T100) antibody |
| Blocking Peptide |
For anti-TCF3 (ARP38267_T100) antibody is Catalog # AAP38267 (Previous Catalog # AAPP20476) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3 |
| Uniprot ID |
P15923 |
| Protein Name |
Transcription factor E2-alpha |
| Sample Type Confirmation |
TCF3 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_003191 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003200 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCF3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 77%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TCF3 Antibody Titration: 0.31ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateTCF3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
