SMARCD2 antibody - C-terminal region (ARP38223_P050)
Data Sheet
 
Product Number ARP38223_P050
Product Page www.avivasysbio.com/smarcd2-antibody-c-terminal-region-arp38223-p050.html
Product Name SMARCD2 antibody - C-terminal region (ARP38223_P050)
Size 100 ul
Gene Symbol SMARCD2
Alias Symbols BAF60B, CRACD2, PRO2451, Rsc6p
Protein Size (# AA) 475 amino acids
Molecular Weight 54kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6603
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Description This is a rabbit polyclonal antibody against SMARCD2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Target Reference Lehner,B. (2004) Genome Res. 14 (7), 1315-1323
Description of Target SMARCD2 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.
Blocking Peptide For anti-SMARCD2 (ARP38223_P050) antibody is Catalog # AAPS05008
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2
Complete computational species homology data Anti-SMARCD2 (ARP38223_P050)
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCD2.
Peptide Sequence Synthetic peptide located within the following region: STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id Q92925-2
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
Sample Type Confirmation

SMARCD2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_003068
Purification Affinity Purified
Protein Interactions NOTCH2NL; UBC; RNF2; BMI1; RBBP5; NUDCD2; SIRT1; BAZ1B; KYNU; ARID1A; TOP2B; SMARCE1; SMARCD1; SMARCC2; SMARCC1; SMARCB1; SMARCA4; SMARCA2; BPTF; CUL3; SMARCAD1; Bcl7b; UNKL; TP63; TP73; TP53; XRN1; BRCA1;
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCD2.
Nucleotide Accession # NM_003077
Replacement Item This antibody may replace item sc-101162 from Santa Cruz Biotechnology.
CB Replacement sc-101162; sc-132105; sc-132106; sc-153618; sc-367954; sc-93762
Conjugation Options

ARP38223_P050-FITC Conjugated

ARP38223_P050-HRP Conjugated

ARP38223_P050-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Lung
Rabbit Anti-SMARCD2 Antibody
Catalog Number: ARP38223
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 16 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-SMARCD2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

SMARCD2 is supported by BioGPS gene expression data to be expressed in Jurkat

Image 3
Human Heart
Rabbit Anti-SMARCD2 Antibody
Catalog Number: ARP38223
Paraffin Embedded Tissue: Human cardiac cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 4
Human MDA-MB-435s Whole Cell

Host: Rabbit
Target Name: SMARCD2
Sample Tissue: Human MDA-MB-435s Whole Cell
Antibody Dilution: 1ug/ml

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com