SMARCA3 Antibody - C-terminal region (ARP38218_T100)

Data Sheet
 
Product Number ARP38218_T100
Product Page www.avivasysbio.com/smarca3-antibody-c-terminal-region-arp38218-t100.html
Name SMARCA3 Antibody - C-terminal region (ARP38218_T100)
Protein Size (# AA) 1009 amino acids
Molecular Weight 114kDa
NCBI Gene Id 6596
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Helicase-like transcription factor
Alias Symbols ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, SMARCA3
Peptide Sequence Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.
Protein Interactions CHFR; UBC; RAD18; SUMO2; RPA3; RPA2; RPA1; WBP4; BRCA1; DTL; SULT1C2; HSPA8; CDK9; NOTCH1; SP3; SP1; SPRTN; Cebpb; ELAVL1; Shprh; RNF146; tat; EWSR1; UBE2Z; RPAP1; USP7; EEF1G; UBE2V2; UBE2N; PCNA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HLTF (ARP38218_T100) antibody
Blocking Peptide For anti-HLTF (ARP38218_T100) antibody is Catalog # AAP38218 (Previous Catalog # AAPP20394)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCA3
Uniprot ID Q14527
Protein Name Helicase-like transcription factor
Protein Accession # NP_620636
Purification Protein A purified
Nucleotide Accession # NM_139048
Tested Species Reactivity Human
Gene Symbol HLTF
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 86%; Rat: 86%
Image 1
Transfected 293T
WB Suggested Anti-SMARCA3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com