website statistics
Product Datasheet: ARP38212_T100 - SIAH1 antibody - C-terminal region (ARP38212_T100) - Aviva Systems Biology
 
SIAH1 antibody - C-terminal region (ARP38212_T100)
Data Sheet
 
Product Number ARP38212_T100
Product Page www.avivasysbio.com/siah1-antibody-c-terminal-region-arp38212-t100.html
Product Name SIAH1 antibody - C-terminal region (ARP38212_T100)
Size 100 ul
Gene Symbol SIAH1
Alias Symbols SIAH1A
Protein Size (# AA) 282 amino acids
Molecular Weight 31kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6477
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Siah E3 ubiquitin protein ligase 1
Description This is a rabbit polyclonal antibody against SIAH1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Target Reference Avraham,E., et al., (2005) J. Biol. Chem. 280 (52), 42877-42886
Description of Target SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Protein Interactions MX1; MAB21L1; KIFC3; KCNJ10; INHA; UBE2K; FLI1; EEF1D; PHC2; PHC1; CDC34; CAPG; BCL6; TRIM23; AQP1; PFKM; ZCCHC13; MTIF3; UPP2; MOB3C; SPATA4; PRR20A; HIST4H4; EXOC3-AS1; PTPMT1; RPS19BP1; SPATC1L; KATNAL1; TRIM7; GDPD5; ZBP1; KIAA1683; ARMC9; KIAA0319L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: Paraffin embedded livertissue, tested with an antibody dilution of 5 ug/ml.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SIAH1 (ARP38212_T100) antibody is Catalog # AAP38212 (Previous Catalog # AAPP20388)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1
Complete computational species homology data Anti-SIAH1 (ARP38212_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SIAH1.
Swissprot Id Q8IUQ4
Protein Name E3 ubiquitin-protein ligase SIAH1
Sample Type Confirmation

SIAH1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_003022
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SIAH1.
Nucleotide Accession # NM_003031
Replacement Item This antibody may replace item sc-22765 from Santa Cruz Biotechnology.
Conjugation Options

ARP38212_T100-FITC Conjugated

ARP38212_T100-HRP Conjugated

ARP38212_T100-Biotin Conjugated

CB Replacement sc-22765; sc-37495; sc-44102; sc-5504; sc-5505; sc-5506; sc-81785; sc-81786; sc-81787; sc-81788
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Placenta
WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Image 2
Human Liver
Liver
Image 3
Human HEK293T
Lanes:
Lane1: 50 ug human HEK-293T lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-IgG
Secondary Antibody Dilution:
1:5000
Gene Name:
SIAH1
Submitted by:
Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University Jena

SIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com