MNAT1 Antibody - C-terminal region (ARP38150_T100)

Data Sheet
 
Product Number ARP38150_T100
Product Page www.avivasysbio.com/mnat1-antibody-c-terminal-region-arp38150-t100.html
Name MNAT1 Antibody - C-terminal region (ARP38150_T100)
Protein Size (# AA) 309 amino acids
Molecular Weight 36kDa
NCBI Gene Id 4331
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
Alias Symbols MAT1, TFB3, CAP35, RNF66
Peptide Sequence Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhou,M., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (22), 12666-12671
Description of Target Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7, cyclin H, and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM].
Protein Interactions RPA3; RPA2; RPA1; CDK7; CDK2; MBP; CTD; CCNH; NGFRAP1; UBC; NKX3-1; USP2; SUPT5H; POLR2A; GTF2H4; GTF2H3; GTF2H1; ERCC2; tat; TRIM39; TRIM34; TRIM17; TRIM2; ICK; TRIM31; RNF41; RNF7; TRIM26; MKRN3; TRIM21; MDM4; BRCA1; TRIML1; RNF32; TRIM9; TRIM5; XBP1P1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MNAT1 (ARP38150_T100) antibody
Blocking Peptide For anti-MNAT1 (ARP38150_T100) antibody is Catalog # AAP38150 (Previous Catalog # AAPS04903)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MNAT1
Uniprot ID P51948
Protein Name CDK-activating kinase assembly factor MAT1
Sample Type Confirmation

MNAT1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_002422
Purification Protein A purified
Nucleotide Accession # NM_002431
Tested Species Reactivity Human
Gene Symbol MNAT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Jurkat
WB Suggested Anti-MNAT1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateMNAT1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com