MXD1 Antibody - N-terminal region (ARP38141_P050)

• Product Number: ARP38141_P050
• Name: MXD1 Antibody - N-terminal region (ARP38141_P050)
• Protein Size (# AA): 221 amino acids
• Molecular Weight: 25 kDa
• NCBI Gene Id: 4084
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: MAX dimerization protein 1
• Alias Symbols: MAD, MAD1, BHLHC58
• Peptide Sequence: Synthetic peptide located within the following region: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rottmann,S., (2008) FASEB J. 22 (4), 1124-1134
• Description of Target: MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. MXD1 competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor.MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: HDAC2; MAX; VDR; APP; BIRC2; RPS6KB1; RPS6KA1; AKT1; SIN3A; KDM5A; SIN3B; PRAM1; SMC3; SAP30; MXD1; MYC; CD2; MYCL; MYCN; PML; MLX; HDAC1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Blocking Peptide: For anti-MXD1 (ARP38141_P050) antibody is Catalog # AAP38141 (Previous Catalog # AAPS04807)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MXD1
• Uniprot ID: Q0VFI9
• Protein Name: Max dimerization protein 1
• Protein Accession #: NP_002348
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002357
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: MXD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 100%
• Image 1: Human Muscle
  
  WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Muscle
• Image 2:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.