| Product Number |
ARP38114_P050 |
| Product Page |
www.avivasysbio.com/hoxb1-antibody-c-terminal-region-arp38114-p050.html |
| Name |
HOXB1 Antibody - C-terminal region (ARP38114_P050) |
| Protein Size (# AA) |
301 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
3211 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox B1 |
| Alias Symbols |
HOX2, HCFP3, HOX2I, Hox-2.9 |
| Peptide Sequence |
Synthetic peptide located within the following region: FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. |
| Protein Interactions |
PKNOX2; PBX1; PAX6; EP300; MEIS1; CREBBP; HOXB1; SERPINA3; NR3C1; HMGB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXB1 (ARP38114_P050) antibody |
| Blocking Peptide |
For anti-HOXB1 (ARP38114_P050) antibody is Catalog # AAP38114 (Previous Catalog # AAPS05607) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB1 |
| Uniprot ID |
P14653 |
| Protein Name |
Homeobox protein Hox-B1 |
| Protein Accession # |
NP_002135 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002144 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-HOXB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate |
|
|
