Product Number |
ARP38090_P050 |
Product Page |
www.avivasysbio.com/egr4-antibody-c-terminal-region-arp38090-p050.html |
Name |
EGR4 Antibody - C-terminal region (ARP38090_P050) |
Protein Size (# AA) |
486 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
1961 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Early growth response 4 |
Alias Symbols |
AT133, NGFIC, NGFI-C, PAT133 |
Peptide Sequence |
Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Decker,E.L., (2003) Nucleic Acids Res. 31 (3), 911-921 |
Description of Target |
The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression. |
Protein Interactions |
NFATC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EGR4 (ARP38090_P050) antibody |
Blocking Peptide |
For anti-EGR4 (ARP38090_P050) antibody is Catalog # AAP38090 (Previous Catalog # AAPP20264) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human EGR4 |
Uniprot ID |
Q05215 |
Protein Name |
Early growth response protein 4 |
Protein Accession # |
NP_001956 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001965 |
Tested Species Reactivity |
Human |
Gene Symbol |
EGR4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91% |
Image 1 | Human Jurkat
| WB Suggested Anti-EGR4 Antibody Titration: 0.0625ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|