EGR4 Antibody - C-terminal region (ARP38090_P050)

Data Sheet
 
Product Number ARP38090_P050
Product Page www.avivasysbio.com/egr4-antibody-c-terminal-region-arp38090-p050.html
Name EGR4 Antibody - C-terminal region (ARP38090_P050)
Protein Size (# AA) 486 amino acids
Molecular Weight 51kDa
NCBI Gene Id 1961
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Early growth response 4
Alias Symbols AT133, NGFIC, NGFI-C, PAT133
Peptide Sequence Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Decker,E.L., (2003) Nucleic Acids Res. 31 (3), 911-921
Description of Target The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
Protein Interactions NFATC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EGR4 (ARP38090_P050) antibody
Blocking Peptide For anti-EGR4 (ARP38090_P050) antibody is Catalog # AAP38090 (Previous Catalog # AAPP20264)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EGR4
Uniprot ID Q05215
Protein Name Early growth response protein 4
Protein Accession # NP_001956
Purification Affinity Purified
Nucleotide Accession # NM_001965
Tested Species Reactivity Human
Gene Symbol EGR4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Image 1
Human Jurkat
WB Suggested Anti-EGR4 Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com