Product Number |
ARP38066_P050 |
Product Page |
www.avivasysbio.com/atf4-antibody-n-terminal-region-arp38066-p050.html |
Name |
Atf4 Antibody - N-terminal region (ARP38066_P050) |
Protein Size (# AA) |
349 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
11911 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Activating transcription factor 4 |
Alias Symbols |
Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67 |
Peptide Sequence |
Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Atf4 remains unknown. |
Protein Interactions |
Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Atf4 (ARP38066_P050) antibody |
Blocking Peptide |
For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066 |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q5U4B2 |
Protein Name |
Cyclic AMP-dependent transcription factor ATF-4 |
Publications |
Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). 24793116 |
Protein Accession # |
NP_033846 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009716 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Atf4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep |
Application |
WB, IHC-P |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93% |
Image 1 | Mouse Kidney
| WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Mouse Kidney |
|
Image 2 | Mouse Kidney
| Host: Rabbit Target Name: ATF4 Sample Tissue: Mouse Kidney Antibody Dilution: 1ug/ml |
|
Image 3 | Mouse Kidney
| Host: Mouse Target Name: ATF4 Sample Tissue: Mouse Kidney Antibody Dilution: 1ug/ml |
|
Image 4 | Mouse Kidney
| Atf4 antibody - N-terminal region (ARP38066_P050) validated by WB using Mouse Kidney at 0.2-1 ug/ml. |
|
Image 5 | human small intestine
| Anti-ATF4 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|