Atf4 Antibody - N-terminal region (ARP38066_P050)

Data Sheet
 
Product Number ARP38066_P050
Product Page www.avivasysbio.com/atf4-antibody-n-terminal-region-arp38066-p050.html
Name Atf4 Antibody - N-terminal region (ARP38066_P050)
Protein Size (# AA) 349 amino acids
Molecular Weight 38kDa
NCBI Gene Id 11911
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Activating transcription factor 4
Alias Symbols Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67
Peptide Sequence Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of Atf4 remains unknown.
Protein Interactions Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Atf4 (ARP38066_P050) antibody
Blocking Peptide For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q5U4B2
Protein Name Cyclic AMP-dependent transcription factor ATF-4
Publications

Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). 24793116

Protein Accession # NP_033846
Purification Affinity Purified
Nucleotide Accession # NM_009716
Tested Species Reactivity Mouse
Gene Symbol Atf4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep
Application WB, IHC-P
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Image 1
Mouse Kidney
WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Kidney
Image 2
Mouse Kidney
Host: Rabbit
Target Name: ATF4
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
Image 3
Mouse Kidney
Host: Mouse
Target Name: ATF4
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
Image 4
Mouse Kidney
Atf4 antibody - N-terminal region (ARP38066_P050) validated by WB using Mouse Kidney at 0.2-1 ug/ml.
Image 5
human small intestine
Anti-ATF4 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com