PAX6 Antibody - N-terminal region (ARP38062_P050)

Data Sheet
 
Product Number ARP38062_P050
Product Page www.avivasysbio.com/pax6-antibody-n-terminal-region-arp38062-p050.html
Name PAX6 Antibody - N-terminal region (ARP38062_P050)
Protein Size (# AA) 436 amino acids
Molecular Weight 48kDa
NCBI Gene Id 5080
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Paired box 6
Alias Symbols AN, AN1, AN2, FVH1, MGDA, WAGR, ASGD5, D11S812E
Peptide Sequence Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,E.A., et al., (2006) J. Biol. Chem. 281 (11), 7489-7497
Description of Target PAX6 is one of many human homologues of the Drosophila melanogaster gene prd. In addition to the hallmark feature of this gene family, a conserved paired box domain, the encoded protein also contains a homeo box domain. Both domains are known to bind DNA,
Protein Interactions IPO13; Dlg4; NKIRAS2; Cacnb3; Pax6; Diap1; SMAD5; SMAD4; SMAD3; SMAD1; AR; HIPK2; SUMO1; SMARCA4; TP73; SHANK3; PBX1; VSX2; EN1; TRIM11; HOMER3; SIX3; INADL; EP300; SOX10; RGS3; DIAPH1; MAFG; RAX; DYNLL1; DLG1; CDX2; TBP; SOX3; MITF; HOXB1; SOX2; LHX2; TA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAX6 (ARP38062_P050) antibody
Blocking Peptide For anti-PAX6 (ARP38062_P050) antibody is Catalog # AAP38062 (Previous Catalog # AAPP20236)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PAX6
Uniprot ID P26367-2
Protein Name Paired box protein Pax-6
Protein Accession # NP_001595
Purification Affinity Purified
Nucleotide Accession # NM_001604
Tested Species Reactivity Human, Mouse
Gene Symbol PAX6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-PAX6 Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Image 2
Mouse Kidney
Host: Mouse
Target Name: PAX6
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com