FOXJ1 Antibody - N-terminal region (ARP38038_P050)

• Product Number: ARP38038_P050
• Name: FOXJ1 Antibody - N-terminal region (ARP38038_P050)
• Protein Size (# AA): 421 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 2302
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Forkhead box J1
• Alias Symbols: HFH4, HFH-4, CILD43, FKHL13
• Peptide Sequence: Synthetic peptide located within the following region: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Li,C.S., (2006) J. Hum. Genet. 51 (4), 292-297
• Description of Target: FOXJ1 is a member of forkhead/winged-helix transcription factor family, which play crucial roles during vertebrate development. FOXJ1 may play an important role in cell fate determination during lung development and in spermatogenesis.The unique pattern of FOXJ1expression during human fetal development suggests a role for this forkhead/winged-helix factor during pulmonary and renal epithelial development. Single nucleotide polymorphisms were identified in FOXJ1 and a significant association was found with allergic rhinitis.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM].
• Protein Interactions: RPUSD1; SLC37A3; NMRAL1; TRMT6; TWF2; OIP5; THRA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXJ1 (ARP38038_P050) antibody is Catalog # AAP38038 (Previous Catalog # AAPP20213)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXJ1
• Uniprot ID: Q92949
• Protein Name: Forkhead box protein J1
• Protein Accession #: NP_001445
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001454
• Tested Species Reactivity: Human
• Gene Symbol: FOXJ1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
• Image 1: Human OVCAR-3 Whole Cell
  
  Host: Rabbit
  Target Name: FOXJ1
  Sample Tissue: Human OVCAR-3 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human HepG2
  
  WB Suggested Anti-FOXJ1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:500
  Positive Control: HepG2 cell lysate