| Product Number |
ARP38021_T100 |
| Product Page |
http://www.avivasysbio.com/anti-ldb2-antibody-c-terminal-region-arp38021-t100.html |
| Product Name |
LDB2 antibody - C-terminal region (ARP38021_T100) |
| Size |
100ug |
| Gene Symbol |
LDB2 |
| Alias Symbols |
LDB1; CLIM1 |
| Nucleotide Accession# |
NM_001290 |
| Protein Accession# |
NP_001281 |
| Swissprot Id |
O43679 |
| Protein Size (# AA) |
373 amino acids |
| Molecular Weight |
43kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
9079 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Protein A purified |
| Official Gene Full Name |
LIM domain binding 2 |
| Description |
This is a rabbit polyclonal antibody against LDB2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: ENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ |
| Key Reference |
Retaux,S., et al., (1999) J. Neurosci. 19 (2), 783-793 |
| Description of Target |
LDB2 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes. |
| Partner Proteins |
PIAS1, CSRP2BP, EEF1A1, PIAS1, CSRP2BP, PIAS1 |
| Reconstitution and Storage |
Add 100 μl of distilled water. Final anti-LDB2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-LDB2 antibody is Catalog # AAP38021 (Previous Catalog # AAPP20194) |
| Immunogen |
The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the C terminal of human LDB2 |
| Complete computational species homology data |
LDB2 antibody - C-terminal region (ARP38021_T100) |
| Tissue Tool |
Find tissues and cell lines supported to express LDB2.  |
| Reviews and Data |
Computational species homology for LDB2 antibody (ARP38021); Product Protocols: LDB2 antibody tested with Human Hepg2 Cells (ARP38021_T100) |
| Homology Short |
African clawed frog, Bovine, Horse, Human, Mouse, Rat, Chicken, Rabbit, Dog, Zebrafish |
| Observed Species Reactivity |
Human, Mouse, Rat, African clawed frog, Chicken, Pig, Dog, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
African clawed frog: 100%; Bovine: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Rabbit: 84%; Dog: 83%; Zebrafish: 76% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LDB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
