website statistics
Product Datasheet: ARP38021_T100 - LDB2 antibody - C-terminal region (ARP38021_T100) - Aviva Systems Biology
 
LDB2 antibody - C-terminal region (ARP38021_T100)
Data Sheet
 
Product Number ARP38021_T100
Product Page http://www.avivasysbio.com/ldb2-antibody-c-terminal-region-arp38021-t100.html
Product Name LDB2 antibody - C-terminal region (ARP38021_T100)
Size 100ug
Gene Symbol LDB2
Alias Symbols LDB1; CLIM1
Nucleotide Accession# NM_001290
Protein Size (# AA) 373 amino acids
Molecular Weight 43kDa
Product Format Lyophilized powder
NCBI Gene Id 9079
Host Rabbit
Clonality Polyclonal
Official Gene Full Name LIM domain binding 2
Description This is a rabbit polyclonal antibody against LDB2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: ENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ
Target Reference Retaux,S., et al., (1999) J. Neurosci. 19 (2), 783-793
Description of Target LDB2 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes.
Partner Proteins PIAS1, CSRP2BP, EEF1A1, PIAS1, CSRP2BP, PIAS1
Reconstitution and Storage Add 100 ul of distilled water. Final anti-LDB2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-LDB2 antibody is Catalog # AAP38021 (Previous Catalog # AAPP20194)
Immunogen The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the C terminal of human LDB2
Complete computational species homology data LDB2 antibody - C-terminal region (ARP38021_T100)
Tissue Tool Find tissues and cell lines supported to express LDB2.
Swissprot Id O43679
Protein Name LIM domain-binding protein 2
Protein Accession # NP_001281
Purification Protein A purified
Species Reactivity Rat, Human, Bovine, Horse, Guinea pig, Mouse, Dog, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 85%; Rabbit: 85%; Zebrafish: 77%
Image 1
Human HepG2
WB Suggested Anti-LDB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

__________________________________________________________________________________________________________________________________________________________________

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com