website statistics
Product Datasheet: ARP38021_T100 - LDB2 antibody - C-terminal region (ARP38021_T100) - Aviva Systems Biology
LDB2 antibody - C-terminal region (ARP38021_T100)
Data Sheet
Product Number ARP38021_T100
Product Page
Product Name LDB2 antibody - C-terminal region (ARP38021_T100)
Size 100 ul
Gene Symbol LDB2
Alias Symbols LDB1, CLIM1
Protein Size (# AA) 373 amino acids
Molecular Weight 43kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 9079
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name LIM domain binding 2
Description This is a rabbit polyclonal antibody against LDB2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: ENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ
Target Reference Retaux,S., et al., (1999) J. Neurosci. 19 (2), 783-793
Description of Target LDB2 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes.
Protein Interactions LHX4; RILP; LMO3; RASIP1; SSBP3; SSBP2; LMO4; TSNAX; UBC; SSBP4; ISL1; LHX9; RLIM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks
*** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
Blocking Peptide For anti-LDB2 (ARP38021_T100) antibody is Catalog # AAP38021 (Previous Catalog # AAPP20194)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LDB2
Complete computational species homology data Anti-LDB2 (ARP38021_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LDB2.
Swissprot Id O43679
Protein Name LIM domain-binding protein 2
Protein Accession # NP_001281
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LDB2.
Nucleotide Accession # NM_001290
Replacement Item This antibody may replace item sc-101088 from Santa Cruz Biotechnology.
Conjugation Options

ARP38021_T100-FITC Conjugated

ARP38021_T100-HRP Conjugated

ARP38021_T100-Biotin Conjugated

CB Replacement sc-101088
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 77%
Image 1
Human HepG2
WB Suggested Anti-LDB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |