BTF3 Antibody - middle region (ARP38015_T100)

Data Sheet
 
Product Number ARP38015_T100
Product Page www.avivasysbio.com/btf3-antibody-middle-region-arp38015-t100.html
Name BTF3 Antibody - middle region (ARP38015_T100)
Protein Size (# AA) 206 amino acids
Molecular Weight 23kDa
NCBI Gene Id 689
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Basic transcription factor 3
Alias Symbols NACB, BTF3a, BTF3b, BETA-NAC
Peptide Sequence Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Oyake,T., et al., (2005) Gene 345 (2), 271-277
Description of Target BTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Protein Interactions TXLNA; TXLNB; NACA; UBC; PDCD4; PPP2R1A; gag-pol; ESR1; CTNNB1; NACA2; RWDD4; PDRG1; RPL29; RPL11; APP; H2AFX; USP17L9P; POLR2B; MED21; CSNK2B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BTF3 (ARP38015_T100) antibody
Blocking Peptide For anti-BTF3 (ARP38015_T100) antibody is Catalog # AAP38015 (Previous Catalog # AAPP20188)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BTF3
Uniprot ID P20290
Protein Name Transcription factor BTF3
Publications

Thakur, D. et al. Human beta casein fragment (54-59) modulates M. bovis BCG survival and basic transcription factor 3 (BTF3) expression in THP-1 cell line. PLoS One 7, e45905 (2012). 23029305

Sample Type Confirmation

BTF3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001032726
Purification Protein A purified
Nucleotide Accession # NM_001037637
Tested Species Reactivity Human
Gene Symbol BTF3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-BTF3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateBTF3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com