TWIST1 Antibody - C-terminal region (ARP37997_T100)

Data Sheet
 
Product Number ARP37997_T100
Product Page www.avivasysbio.com/twist1-antibody-c-terminal-region-arp37997-t100.html
Name TWIST1 Antibody - C-terminal region (ARP37997_T100)
Protein Size (# AA) 202 amino acids
Molecular Weight 21kDa
NCBI Gene Id 7291
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Twist homolog 1 (Drosophila)
Description
Alias Symbols CRS, CSO, SCS, ACS3, CRS1, BPES2, BPES3, SWCOS, TWIST, bHLHa38
Peptide Sequence Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Reinhold,M.I., et al., (2006) J. Biol. Chem. 281 (3), 1381-1388
Description of Target Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.
Protein Interactions UBC; HOXA5; ETS2; TP53; KAT2B; SETD8; HES6; MTA2; BRAP; TCF3; RELA; PPP2CA; HDAC2; CHD3; TWIST2; ELSPBP1; WDR5; HDAC3; RBBP7; CHD4; SOX2; EP300; TWIST1; GLI3; MYOD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TWIST1 (ARP37997_T100) antibody
Additional Information IHC Information: Paraffin embedded uterus tissue, tested with an antibody dilution of 5 ug/ml.
Blocking Peptide For anti-TWIST1 (ARP37997_T100) antibody is Catalog # AAP37997 (Previous Catalog # AAPP20171)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TWIST1
Uniprot ID Q15672
Protein Name Twist-related protein 1
Publications

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, a9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). 24668500

Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor. Cancer Cell. 26, 222-34 (2014). 25117710

Protein Accession # NP_000465
Purification Protein A purified
Nucleotide Accession # NM_000474
Tested Species Reactivity Human
Gene Symbol TWIST1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 79%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-TWIST1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Image 2
Human Uterus
Uterus
Image 3
Jurkat
Host: Rabbit
Target Name: TWIST1
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%
Image 4
A549, U937
Host: Rabbit
Target: TWIST1
Positive control (+): A549 (N03)
Negative control (-): U937 (N31)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com