WT1 Antibody - N-terminal region (ARP37988_P050)

Data Sheet
 
Product Number ARP37988_P050
Product Page www.avivasysbio.com/wt1-antibody-n-terminal-region-arp37988-p050.html
Name WT1 Antibody - N-terminal region (ARP37988_P050)
Protein Size (# AA) 497 amino acids
Molecular Weight 54kDa
NCBI Gene Id 7490
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Wilms tumor 1
Alias Symbols GUD, AWT1, WAGR, WT33, NPHS4, WIT-2
Peptide Sequence Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.
Protein Interactions KRTAP10-3; KRTAP10-8; KRT40; EGR1; MDM2; DVL3; CIAO1; TP53; HSPA4; TAOK1; NPM3; ZNF205; SUZ12; MEN1; EZH2; DNMT1; WTIP; WTAP; PAWR; UBE2I; TP63; FHL2; TP73; PRKACA; CREBBP; U2AF2; PAX2; AREG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WT1 (ARP37988_P050) antibody
Blocking Peptide For anti-WT1 (ARP37988_P050) antibody is Catalog # AAP37988 (Previous Catalog # AAPP20090)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human WT1
Uniprot ID E9PMK7
Protein Accession # NP_000369
Purification Affinity Purified
Nucleotide Accession # NM_000378
Tested Species Reactivity Human
Gene Symbol WT1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HeLa
WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com