FBN1 Antibody - N-terminal region (ARP37969_P050)

Data Sheet
 
Product Number ARP37969_P050
Product Page www.avivasysbio.com/fbn1-antibody-n-terminal-region-arp37969-p050.html
Name FBN1 Antibody - N-terminal region (ARP37969_P050)
Protein Size (# AA) 195 amino acids
Molecular Weight 21kDa
NCBI Gene Id 2200
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Fibrillin 1
Alias Symbols FBN, SGS, WMS, MASS, MFLS, MFS1, OCTD, SSKS, WMS2, ACMICD, ECTOL1, GPHYSD2
Peptide Sequence Synthetic peptide located within the following region: MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Uyeda,T., et al., (2004) J. Hum. Genet. 49 (8), 404-407
Description of Target FBN1 is a member of the fibrillin family. FBN1 is a large, extracellular matrix glycoprotein that serve as a structural component of 10-12 nm calcium-binding microfibrils. These microfibrils provide force bearing structural support in elastic and nonelastic connective tissue throughout the body. Mutations in this gene are associated with Marfan syndrome, isolated ectopia lentis, autosomal dominant Weill-Marchesani syndrome, MASS syndrome, and Shprintzen-Goldberg craniosynostosis syndrome.
Protein Interactions UBC; SPRY2; ATXN7; MYOC; MFAP5; MFAP2; LTBP1; HSPG2; FBLN2; ELN; DCN; FBN2; VCAN; CALR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FBN1 (ARP37969_P050) antibody
Blocking Peptide For anti-FBN1 (ARP37969_P050) antibody is Catalog # AAP37969 (Previous Catalog # AAPP20072)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FBN1
Uniprot ID Q75N89
Protein Name Fibrillin 1 EMBL BAD16737.1
Protein Accession # BAD16737
Purification Affinity Purified
Nucleotide Accession # NM_000138
Tested Species Reactivity Human
Gene Symbol FBN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 79%
Image 1
Human Jurkat
WB Suggested Anti-FBN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com