| Product Number |
ARP37923_T100 |
| Product Page |
www.avivasysbio.com/taf7l-antibody-middle-region-arp37923-t100.html |
| Name |
TAF7L Antibody - middle region (ARP37923_T100) |
| Protein Size (# AA) |
378 amino acids |
| Molecular Weight |
42kDa |
| Subunit |
7-like |
| NCBI Gene Id |
74469 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor |
| Alias Symbols |
Taf2, Taf2q, 4933438I11Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pointud,J.C., et al., (2003) J. Cell. Sci. 116 (PT 9), 1847-1858 |
| Description of Target |
TAF7I belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs). |
| Protein Interactions |
Tbp; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TAF7L (ARP37923_T100) antibody |
| Blocking Peptide |
For anti-TAF7L (ARP37923_T100) antibody is Catalog # AAP37923 (Previous Catalog # AAPP20034) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L |
| Uniprot ID |
Q99MW7 |
| Protein Name |
Transcription initiation factor TFIID subunit 7-like |
| Protein Accession # |
NP_083234 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_028958 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TAF7L |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Human: 77%; Mouse: 100%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-TAF7L Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
|
